PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.N02478.1.p
Common NameMIMGU_mgv1a022798mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NAC
Protein Properties Length: 193aa    MW: 22022.8 Da    PI: 9.8314
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.N02478.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM142.72.2e-4441391128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                       +ppGfrF Pt+eelv++yL++k+e+++    +++++vi+ +diy++ePw+Lpk     ++++ ++w+fF++r++++ +g +++r+t +gyWka
  Migut.N02478.1.p   4 MPPGFRFYPTEEELVSFYLHNKLENNNnnnnNSINRVIPLLDIYNLEPWQLPKhcgeLCHGDPEQWFFFAPRHEREVRGGKPRRTTGTGYWKA 96 
                       79**********************99966655666689999***********645543344677***************************** PP

               NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       tg+   v+s+ g+++g+kk++vfykg+ap+g+kt+W m+eyr+
  Migut.N02478.1.p  97 TGSPSYVHSSAGKVIGVKKSMVFYKGKAPTGTKTKWKMNEYRA 139
                       *****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-483162IPR003441NAC domain
PROSITE profilePS5100548.0624163IPR003441NAC domain
PfamPF023651.5E-245138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MEEMPPGFRF YPTEEELVSF YLHNKLENNN NNNNNSINRV IPLLDIYNLE PWQLPKHCGE  60
LCHGDPEQWF FFAPRHEREV RGGKPRRTTG TGYWKATGSP SYVHSSAGKV IGVKKSMVFY  120
KGKAPTGTKT KWKMNEYRAI KQDGPTSTPK LRHELSLCRV YVVSGSRRAF DRRPTAAAET  180
SSRVNSQENN DD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-37416120166NAC domain-containing protein 19
3swm_B4e-37416120166NAC domain-containing protein 19
3swm_C4e-37416120166NAC domain-containing protein 19
3swm_D4e-37416120166NAC domain-containing protein 19
3swp_A4e-37416120166NAC domain-containing protein 19
3swp_B4e-37416120166NAC domain-containing protein 19
3swp_C4e-37416120166NAC domain-containing protein 19
3swp_D4e-37416120166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012838527.11e-144PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR39e-80NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A022RAV31e-137A0A022RAV3_ERYGU; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000677074e-87(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-69NAC domain containing protein 90